PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G142000.1
Common NameB456_006G142000, LOC105797936
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 318aa    MW: 36565 Da    PI: 8.2081
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G142000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.5e-32147201155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWt++LHe+Fve+v++LGG ekAtPktil+lm+ +gLt+ hvkSHLQkYR+
  Gorai.006G142000.1 147 KTRIRWTQDLHEKFVECVKRLGGCEKATPKTILKLMDTQGLTIFHVKSHLQKYRT 201
                         68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-28144202IPR009057Homeodomain-like
PROSITE profilePS5129411.363144204IPR017930Myb domain
SuperFamilySSF466891.79E-16146201IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-23147201IPR006447Myb domain, plants
PfamPF002497.2E-9151200IPR001005SANT/Myb domain
PfamPF143792.8E-19229274IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MNTKRTDCQE LARQSLGFNR NCNLQPAMEG VPQQLNHGSS SSNPIMSGFQ TPAYAFNATE  60
RRIQLDTSSF CPQHNIYSSI ESIAQDEPNY DFRNTLQSLV KSQICFDQYQ KSFERSYKFP  120
GSNAKTHFSF PSRVNQDQRA YCNKSNKTRI RWTQDLHEKF VECVKRLGGC EKATPKTILK  180
LMDTQGLTIF HVKSHLQKYR TARYMPEFTQ EGRTSTTDLT QIDVKTGLHL TEALQLQLDV  240
QRRLNEQLEF QRNLQLRIEE QGRRLKMMID EQQQKANESL LKNQGVDIKP YEHDPSFSDL  300
DSSIAETSEN VLTSGPC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012483256.10.0PREDICTED: uncharacterized protein LOC105797936
SwissprotQ8GUN56e-48PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A0D2RW890.0A0A0D2RW89_G
STRINGPOPTR_0006s20540.17e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2443434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-66G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]